DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCDC53 and ddl-1

DIOPT Version :9

Sequence 1:NP_609178.1 Gene:CCDC53 / 34097 FlyBaseID:FBgn0031979 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001370457.1 Gene:ddl-1 / 173954 WormBaseID:WBGene00019125 Length:189 Species:Caenorhabditis elegans


Alignment Length:170 Identity:51/170 - (30%)
Similarity:81/170 - (47%) Gaps:11/170 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKFVEMERQLQKTEAALI 65
            |:|::.....:|..::||::..|.....|..::.....||.|....|....:.|:.|...:..|.
 Worm     1 MNASSRTKPAIDLNKVPPIDHHRTAVTFNCLIMKMTEMLNNFGNKMEDILEKAEQSLDTADRKLR 65

  Fly    66 ILEAKLASIPTEHHVATEAT--EAPAISN-QQRNEEASMVDTTEPPTTENPTEPELPPESVGVRA 127
            ::|:|||.:..|.. :|.||  .||.|.. .:.|..:|.:  .|....|.|.|     .:..|..
 Worm    66 LMESKLAGMSLEDK-STTATPSSAPEIDEIHESNPSSSQI--VEETVEEKPEE-----HTTTVLI 122

  Fly   128 CEDQRYRKFFKMVQVGVPAPAVKQKMQSEGLEPRILDTPD 167
            .:|..|.|:|||:::||....|.|||:|||::|.||...|
 Worm   123 KDDPAYSKYFKMLKLGVLEAGVIQKMKSEGVDPSILKRGD 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCDC53NP_609178.1 DUF2360 28..164 CDD:287161 43/138 (31%)
ddl-1NP_001370457.1 CCDC53 28..158 CDD:401961 42/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159571
Domainoid 1 1.000 56 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG4496
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I3927
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56897
OrthoDB 1 1.010 - - D1425330at2759
OrthoFinder 1 1.000 - - FOG0006422
OrthoInspector 1 1.000 - - oto19810
orthoMCL 1 0.900 - - OOG6_105305
Panther 1 1.100 - - LDO PTHR13015
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2443
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.