DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baf and Banf2

DIOPT Version :9

Sequence 1:NP_001260220.1 Gene:baf / 34095 FlyBaseID:FBgn0031977 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001038215.1 Gene:Banf2 / 403171 MGIID:2684961 Length:90 Species:Mus musculus


Alignment Length:90 Identity:34/90 - (37%)
Similarity:50/90 - (55%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMK 65
            |...|.:.|.|::||:|.|.|..:.||...|...|...||:.||.:|||:|::.|:|..|:.|:.
Mouse     1 MDDMSPRLRAFLSEPIGEKDVAWVDGISRELAINLVTKGFNKAYVLLGQFLLMHKNEAEFQRWII 65

  Fly    66 EVCHASSKQASDCYNCLNDWCEEFL 90
            ..|.|:..:|.....||.:||..||
Mouse    66 CCCGATECEARQSSTCLKEWCSCFL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bafNP_001260220.1 BAF 2..87 CDD:281026 30/84 (36%)
Banf2NP_001038215.1 BAF 4..89 CDD:322424 31/84 (37%)
Barrier to autointegration factor. The BAF protein has a SAM-domain-like bundle of orthogonally packed alpha-hairpins - one classic and one pseudo helix-hairpin-helix motif. The protein is involved in the prevention of retroviral DNA integration 5..89 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.