DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baf and BANF2

DIOPT Version :9

Sequence 1:NP_001260220.1 Gene:baf / 34095 FlyBaseID:FBgn0031977 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001152967.1 Gene:BANF2 / 140836 HGNCID:16172 Length:97 Species:Homo sapiens


Alignment Length:92 Identity:33/92 - (35%)
Similarity:51/92 - (55%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMK 65
            |...|.:.|.|::||:|.|.|..:.||...|...|...|.:.||.:|||:|::.|:|..|:.|: 
Human     8 MDNMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWL- 71

  Fly    66 EVC--HASSKQASDCYNCLNDWCEEFL 90
             :|  .|:..:|....:||.:||..||
Human    72 -ICCFGATECEAQQTSHCLKEWCACFL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bafNP_001260220.1 BAF 2..87 CDD:281026 29/86 (34%)
BANF2NP_001152967.1 BAF 10..96 CDD:296051 30/87 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617480at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.