DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baf and Banf1

DIOPT Version :9

Sequence 1:NP_001260220.1 Gene:baf / 34095 FlyBaseID:FBgn0031977 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_446083.1 Gene:Banf1 / 114087 RGDID:620662 Length:89 Species:Rattus norvegicus


Alignment Length:87 Identity:56/87 - (64%)
Similarity:72/87 - (82%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVC 68
            ||||||:|||||||.|.|..|||||:.||.||::.|||.||.||||:|||||||:||::|:|:.|
  Rat     3 TSQKHRDFVAEPMGEKPVGSLAGIGDALGKRLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTC 67

  Fly    69 HASSKQASDCYNCLNDWCEEFL 90
            .|::||:.||:.||.:||:.||
  Rat    68 GANAKQSRDCFGCLREWCDAFL 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bafNP_001260220.1 BAF 2..87 CDD:281026 53/82 (65%)
Banf1NP_446083.1 BAF 1..86 CDD:397214 53/82 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5131
eggNOG 1 0.900 - - E1_KOG4233
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2866
Inparanoid 1 1.050 131 1.000 Inparanoid score I4539
OMA 1 1.010 - - QHG48331
OrthoDB 1 1.010 - - D1617480at2759
OrthoFinder 1 1.000 - - FOG0006364
OrthoInspector 1 1.000 - - oto97481
orthoMCL 1 0.900 - - OOG6_107233
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5319
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.