DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and Pla1a

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:272 Identity:83/272 - (30%)
Similarity:131/272 - (48%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KFNPELDTKILVHGWKS-STMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYL---TPARYTV 194
            :||..|.||:::||::: .|..:.|.....|.:.....||.|::|...:..:|:.   ...:.::
  Rat    77 EFNASLGTKLIIHGFRALGTKPSWINKFIRALLRAADANVIAVDWVYGSTGMYFSAVENVVKLSL 141

  Fly   195 QVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIG 259
            ::.|.::||::|.|.|     :.||:||.|||||:.|..|.:.|.::.||||||||.|.:... .
  Rat   142 EISRFLSKLLELGVSE-----SSIHIIGVSLGAHVGGMVGHFYKGQLGRITGLDPAGPEYTRA-S 200

  Fly   260 PENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTG-----CSHGR 319
            .|..||..||.||:.||:....||.|.|:|.||::.| ||..||||...  |..|     |.|.|
  Rat   201 LEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVN-GGQDQPGCPAF--IHAGYSYLICDHMR 262

  Fly   320 SYEYYAESINSPKGFYGVPCSGLDELKGKNCT-------------------GGKILMGDPVPREA 365
            :...|..::.:.......||:........:|.                   |.||   :|:|:|.
  Rat   263 AVHLYISALENTCPLMAFPCASYKAFLAGDCLDCFNPFLLSCPRIGLVERGGVKI---EPLPKEV 324

  Fly   366 RGIFFVKTANKP 377
            | ::...|::.|
  Rat   325 R-VYLQTTSSAP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 81/267 (30%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 83/272 (31%)
Pancreat_lipase_like 49..332 CDD:238363 81/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.