DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and Pla1a

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:271 Identity:80/271 - (29%)
Similarity:133/271 - (49%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 AEKFNPELDTKILVHGWKS-STMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYL---TPARY 192
            :.:||..|.||:::||::: .|..:.|.....|.:.....||.|::|...:..:||.   ...:.
Mouse    75 SSEFNASLGTKVIIHGFRALGTKPSWIDKFISAVLRAADANVIAVDWVYGSTGVYYSAVENVVKL 139

  Fly   193 TVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDC 257
            ::::.|.::||::|.|.|     :.||:||.|||||:.|..|.:.|.::.:|||||||.|.:...
Mouse   140 SLEISRFLSKLLELGVSE-----SSIHIIGVSLGAHVGGMVGHFYKGQLGQITGLDPAGPEYTRA 199

  Fly   258 IGPENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQI---FTGCSHGR 319
             ..|..||..||.||:.||:....||.|.|:|.||::.| ||..||||......   :..|.|.|
Mouse   200 -SLEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVN-GGQDQPGCPAFFHAGYNYLICDHMR 262

  Fly   320 SYEYYAESINSPKGFYGVPCSGLDELKGKNC------------------TGGKILMGDPVPREAR 366
            :...|..::.:.......||:........:|                  .||  :|.:|:|:|.:
Mouse   263 AVHLYISALENTCPLMAFPCASYKAFLAGDCLDCFNPFLLSCPRIGLVERGG--VMIEPLPKEVK 325

  Fly   367 GIFFVKTANKP 377
             ::.:.|::.|
Mouse   326 -VYLLTTSSAP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 78/266 (29%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 80/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.