DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and Liph

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:269 Identity:93/269 - (34%)
Similarity:130/269 - (48%) Gaps:46/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 TKILVHGWKSS-----TMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAV 200
            |..::||::.:     .|...:||:    |...::||..::|...|..:.|...:..|.:|...:
  Rat   108 TTFIIHGFRPTGSPPVWMEELVQSL----ISVQEMNVVVVDWNRGATTVIYPHASSKTRKVALIL 168

  Fly   201 AKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIG--PENH 263
            .:.||.:: .|.|..:.|::||.||||||.|:.|.....::.||||||||.|.|.   |  ||:.
  Rat   169 KEFIDQML-AKGASLDNIYMIGVSLGAHIAGFVGEMYSGKLGRITGLDPAGPLFN---GRPPEDR 229

  Fly   264 LDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTG-----CSHGRSYEY 323
            ||.:||.|||||||....||:|:.:|.:||||| ||..||||.:  .||.|     |.|..|...
  Rat   230 LDPSDAQFVDVIHSDTDALGYREALGHIDFYPN-GGLDQPGCPK--TIFGGIKYFKCDHQMSVFL 291

  Fly   324 YAESINSPKGFYGVPC-SGLDELKGK--NCTGGKIL----MG-------------DPVPREARGI 368
            |..|:.:.......|| |..|...||  :|..|.|:    :|             ||...:|   
  Rat   292 YLASLQNNCSITAYPCDSYRDYRNGKCVSCGAGHIVSCPSLGYYADNWREYLWDRDPPMTKA--- 353

  Fly   369 FFVKTANKP 377
            ||.....||
  Rat   354 FFDTAETKP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 91/264 (34%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 86/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.