DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and PNLIP

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:317 Identity:103/317 - (32%)
Similarity:150/317 - (47%) Gaps:49/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KFELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQSI 160
            :|.||.::         :.|||   |....|:.......|.....|:.::||:......|.:.::
Human    54 RFLLYTNE---------NPNNF---QEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANV 106

  Fly   161 RGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQ-VGRAVAKLIDLLVEEKDADPNRIHLIGHS 224
            .....:...||...::||..:...|  |.|...:: ||..||..::.|.......|:.:|:||||
Human   107 CKNLFKVESVNCICVDWKGGSRTGY--TQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHS 169

  Fly   225 LGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIGPE-NHLDDTDANFVDVIHSCAGYL------ 282
            ||||..|.||..|...:.||||||||.|.|:..  || ..||.:||.||||||:....:      
Human   170 LGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGT--PELVRLDPSDAKFVDVIHTDGAPIVPNLGF 232

  Fly   283 GFRKPIGMVDFYPNGGGPPQPGCKE--LSQI------------FTGCSHGRSYEYYAESINSPKG 333
            |..:.:|.:||:|| ||...||||:  ||||            |..|:|.|||:||.:||.:|.|
Human   233 GMSQVVGHLDFFPN-GGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDG 296

  Fly   334 FYGVPCSGLDELKGKNC----TGGKILMG---DPVPREARGI---FFVKTANKPSYA 380
            |.|.||:..:......|    :||...||   |..|.:...:   |::.|.:..::|
Human   297 FAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 98/290 (34%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 102/314 (32%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.