DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and CG10116

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:126/272 - (46%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 QEMAEKFNPELD------------TKILVHGWKSSTMSNSIQSIRGAYIERGQVNVFAINWKDQA 181
            ||.|:....|::            |.:.:..|..:..|..|.::..|.:::...|:.:::     
  Fly    32 QENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVD----- 91

  Fly   182 DNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKY----RVN 242
                 |:.|....::..:||.|:.:|..:.|...:||.::|.:.|||:.|...:..:.    :::
  Fly    92 -----LSEANDETEIIDSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLS 151

  Fly   243 RITGLDPARPAFEDCIGPENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKE 307
            :||.|||:..|..|     :.|...||.||:|:|:.||..|..:.:|.||:||| ||..||||..
  Fly   152 QITALDPSSGAELD-----HKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPN-GGQTQPGCTT 210

  Fly   308 LSQIFTGCSHGRSYEYYAESINSPKGFYGVPCSGLDELKGKNCTGGKILMGDPVPRE--ARGIFF 370
            .|     |||.|::|..||..:....|....|..::.|...:|......||.....|  |.||:|
  Fly   211 DS-----CSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRWSTHKMGQKQEEEQPASGIYF 270

  Fly   371 VKTANKPSYALG 382
            ::|.....::.|
  Fly   271 LETRQSSPFSRG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 72/262 (27%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 72/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.