DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and lipca

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:345 Identity:103/345 - (29%)
Similarity:150/345 - (43%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PENRINL---PQLIKFELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILVH 146
            ||.|:.:   |:.: |.:|     :..::..|....|..|.|..|     |..||..|...|::|
Zfish    32 PEARMKMRYEPKSV-FRVY-----TDGEYTEDTCALELFQPHTLD-----ACGFNSSLPLAIIIH 85

  Fly   147 GWKSSTMSNSIQSIRGAYIER---------GQVNVFAINWKDQADNIYYLTPARYTVQVGRAVAK 202
            ||       |:..:...:|.|         |.:||...:|...|.. :|...|:.|..||:.:|.
Zfish    86 GW-------SVDGMMEKWISRLASALKSSEGNINVLIADWLTLAHQ-HYPIAAQNTRIVGQDIAH 142

  Fly   203 LIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGS---YTKYRVNRITGLDPARPAFE-----DCIG 259
            |:..|.:.|.....::||||:||||||.|:|||   .:...:.||||||||.|.||     |.:.
Zfish   143 LLSWLEDFKQFPLGKVHLIGYSLGAHISGFAGSNLAMSGRTLGRITGLDPAGPMFEGMSHTDRLS 207

  Fly   260 PENHLDDTDANFVDVIHSCA----GY-LGFRKPIGMVDFYPNGGGPPQPGCK-ELSQIF------ 312
            ||      ||.|||.||:..    |. :|.::|:...|||||||. .||||: .:..|:      
Zfish   208 PE------DAKFVDAIHTFTLQRMGLSVGIKQPVAHFDFYPNGGS-FQPGCQLHMQNIYAHLAQH 265

  Fly   313 --------TGCSHGRSYEYYAES-INSPKGFYGVPCSGLDELKGKNCTGGK----ILMGDPVPRE 364
                    ..|:|.|:...:.:| :|..|......||........||...:    ..:|..:.:.
Zfish   266 GIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDNTAFDKGNCLDCRKNRCNTLGYDIKKV 330

  Fly   365 ARG---IFFVKTANKPSYAL 381
            ..|   ..|:||.:...|.|
Zfish   331 RTGKSKRLFLKTRSHMPYKL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 93/303 (31%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 99/333 (30%)
Pancreat_lipase_like 54..344 CDD:238363 95/309 (31%)
PLAT_LPL 351..485 CDD:238856 103/345 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.