DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and CG10163

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:257 Identity:70/257 - (27%)
Similarity:108/257 - (42%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 NPELDTKILVHGWKSSTMSNSIQS-IRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRA 199
            |||..|.|.|:.:.::....|:|. :......|..:||..:::......:||......:|. |..
  Fly   110 NPERKTLIYVNAFHTADSYFSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVN-GYF 173

  Fly   200 VAKLIDLLVEEKDAD--PNRIHLIGHSLGAHIMGYAGSY----TKYRVNRITGLDPARPAFEDCI 258
            |.||:..|   |||.  ...|.|.|||:||:|.......    .|..|.::..:|||..    |.
  Fly   174 VYKLLRAL---KDAGIAVQDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPATM----CR 231

  Fly   259 GPENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGG-----PPQPGCKELSQIFTGCSHG 318
            ..:..:..:.|..|.|:|......|.|.|:|.:|.||||.|     ..||||:  |:|   |||.
  Fly   232 TTDILVKQSVALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCE--SKI---CSHM 291

  Fly   319 RSYEYYAESINSPKGFYGVPCSGLDELKGKNCT-GGKILMGDPVPREARGIFFVKTANKPSY 379
            ..:..:.|::..........|....:.:..:|. ...|.:|...|..|:|::|..|...|.:
  Fly   292 YPFILFMEALIEGVMIPATKCESWAKFRQGDCNFQNTINIGLIYPANAKGLYFCMTQPNPPF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 68/250 (27%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.