DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and CG5162

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:300 Identity:109/300 - (36%)
Similarity:159/300 - (53%) Gaps:48/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SSSSADFWIDENNFE---------FPQRHKRDTWQEMAEKFNPELDTK----ILVHGWKSSTM-S 154
            |..|.|  |::.||:         ||.......|:      :|..|.|    ||..||.::.. |
  Fly    91 SKYSPD--INKMNFQLQTACEKKNFPLTSPESMWK------SPLFDVKKKVVILATGWTTTVNGS 147

  Fly   155 NSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAVA----KLIDLLVEEKDADP 215
            ::|:....||..||.||..|::.....|.:|..: |..|.::|..:|    ||:||:..|     
  Fly   148 DTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWS-AFNTEEIGENIALGLVKLLDLVPVE----- 206

  Fly   216 NRIHLIGHSLGAHIMGYAGSYTKYRVN----RITGLDPARPAFEDCIGPE-NHLDDTDANFVDVI 275
             .||||||||||||:|.||.:.::..|    ||||||||:|.|.:  |.. :.|...||:|||||
  Fly   207 -NIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNE--GEALSGLMRGDAHFVDVI 268

  Fly   276 HSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTGCSHGRSYEYYAESI--NSPKGFYGVP 338
            ||..|.||.|.|:|.|||||.|..|...||..::     |:|.||:||:||::  .:.:.|....
  Fly   269 HSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSVT-----CAHARSWEYFAETVFPGNERNFMATR 328

  Fly   339 CSGLDELKGKNCTGGKILMGDPVPREARGIFFVK-TANKP 377
            |:.:.:|:...|.|.::.||..||:..:|.:|:: :|:.|
  Fly   329 CNSISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 103/284 (36%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 107/296 (36%)
Pancreat_lipase_like 99..365 CDD:238363 103/285 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.