DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and CG1986

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:262 Identity:83/262 - (31%)
Similarity:121/262 - (46%) Gaps:20/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KFNPELDTKILVHGWKSSTMSNSIQSIRGAY-IERGQVNVFAINWKDQADNIYYLTPARYTVQVG 197
            :.:|.....:.:|||......:.:|.:...: :.....||..::|.:.:.| .|.:.:.....||
  Fly    88 RLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQN-DYKSASMSIFDVG 151

  Fly   198 RAVAKLIDLLVEEKDADPNRIH-----LIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFE-- 255
            ..||.:|..|.|.:   ||..|     |.|:|||||..||||:..:.:|.:|.|||||.|.|.  
  Fly   152 LTVAGIIMALEELR---PNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLP 213

  Fly   256 DCIGPENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIF-------T 313
            ..:.|:..||..||.||.|:|:..|.||.....|..|||||||..||..||..:.:.       .
  Fly   214 AEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPV 278

  Fly   314 GCSHGRSYEYYAESINSPKGFYGVPCSGLDELKGKNCTGG-KILMGDPVPREARGIFFVKTANKP 377
            .|||..:..::.:|::....|.|..|....|.....|.|. |...|....|.|:|.|:.:||.:.
  Fly   279 SCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQ 343

  Fly   378 SY 379
            .|
  Fly   344 PY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 80/255 (31%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.