DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and CG5966

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:396 Identity:116/396 - (29%)
Similarity:173/396 - (43%) Gaps:96/396 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KTWIYMPNGQGKPEVAYLVEPPPENRINLPQLIKFELYGSDSSSSADFWIDENNFEFPQR----- 122
            :|.:|:.|...:..|..||:.||..:.::.::..|.:||....:.....:..:....||:     
  Fly    13 QTMLYLANHTSRAAVNTLVDLPPAPKSDINEVKCFGVYGCFPINGPWNTVTRSINVHPQKPSEIE 77

  Fly   123 -----HKR--------------DTWQEMAEKFNPELDTKILVHGWKSS-------TMSNSIQSIR 161
                 |.|              ::.|.|.  .||:....:||||:..|       .|:.::.   
  Fly    78 PHFTLHTRRALDQPKYLDLNDPESVQGMG--MNPKGKIFLLVHGYLESGEIPWMWDMAKALL--- 137

  Fly   162 GAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPN--RIHLIGHS 224
             |:...|:.:|..|:|...|...|....|...: ||...|.::.:|.||... ||  .:|:||||
  Fly   138 -AHEPEGRASVVLIDWGGGASPPYVQAVANIRL-VGAITAHVVHMLYEELRL-PNLDNVHIIGHS 199

  Fly   225 LGAHIMGYAGSYTKY----RVNRITGLDPARPAFEDCIGPENHLDDTDANFVDVIHSCA-----G 280
            ||||:.||||.:.::    :..||||||||.|.|.| ..|...||.|||:|||::|:.|     |
  Fly   200 LGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTD-TDPIVRLDKTDAHFVDIVHTDANPLMKG 263

  Fly   281 YLGFRKPIGMVDFYPNGGGPPQPGCKE-------------LSQIFTGCSHGRSYEYYAESINSPK 332
            .||....:|.|||:||||. ..|||.:             ..|.|.||:|.||.:|:.|||.|..
  Fly   264 GLGINMRLGHVDFFPNGGF-DNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQC 327

  Fly   333 GFYGVPCSGLDELKGKNCTG-------------------------GKILMGDPVPREARGIFFVK 372
            .|.|:.|...:..|...||.                         |::..||     :.|:|::.
  Fly   328 PFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGD-----SPGVFYLW 387

  Fly   373 TA-NKP 377
            |. :||
  Fly   388 TGDSKP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 102/338 (30%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 108/363 (30%)
Pancreat_lipase_like 76..390 CDD:238363 101/328 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.