DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and LIPH

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:221 Identity:75/221 - (33%)
Similarity:111/221 - (50%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 TKILVHGWKSS-----TMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAV 200
            |..:|||::.:     .|.:.::.:    :....:||..::|...|..:.|...:..|.:|...:
Human    71 TTFIVHGFRPTGSPPVWMDDLVKGL----LSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVL 131

  Fly   201 AKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIGP-ENHL 264
            .:.||.::.| .|..:.|::||.||||||.|:.|......:.||||||||.|.|..  .| ::.|
Human   132 KEFIDQMLAE-GASLDDIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNG--KPHQDRL 193

  Fly   265 DDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTG-----CSHGRSYEYY 324
            |.:||.|||||||....||:::|:|.:||||| ||..||||.:  .|..|     |.|.||...|
Human   194 DPSDAQFVDVIHSDTDALGYKEPLGNIDFYPN-GGLDQPGCPK--TILGGFQYFKCDHQRSVYLY 255

  Fly   325 AESINSPKGFYGVPCSGLDELKGKNC 350
            ..|:.........||....:.:...|
Human   256 LSSLRESCTITAYPCDSYQDYRNGKC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 75/221 (34%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 75/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.