DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:292 Identity:98/292 - (33%)
Similarity:141/292 - (48%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KFELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQSI 160
            :|.||.::         :.||::...  ..|.....|..|..:..|:.::||             
Mouse    68 RFLLYTNE---------NPNNYQIIS--ATDPATINASNFQLDRKTRFIIHG------------- 108

  Fly   161 RGAYIERGQ----------------VNVFAINWKDQADNIYYLTPARYTVQ-VGRAVAKLIDLLV 208
               :|::|:                ||...::||..:...|  |.|.|..: ||..:|.|:.:|.
Mouse   109 ---FIDKGEEGWLLDMCKKMFQVEKVNCICVDWKRGSRTEY--TQASYNTRVVGAEIAFLVQVLS 168

  Fly   209 EEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIGPENHLDDTDANFVD 273
            .|....|..:||||||||:|:.|.||...:..|.||||||||.|.|:. :..|..||.:||.|||
Mouse   169 TEMGYSPENVHLIGHSLGSHVAGEAGRRLEGHVGRITGLDPAEPCFQG-LPEEVRLDPSDAMFVD 232

  Fly   274 VIHSCAG----YLGF--RKPIGMVDFYPNGGGPPQPGCKE--LSQI------------FTGCSHG 318
            |||:.:.    ||||  .:.:|.:||:|| ||...|||::  ||.|            |..|:|.
Mouse   233 VIHTDSAPIIPYLGFGMSQKVGHLDFFPN-GGKEMPGCQKNILSTIVDINGIWEGTRNFAACNHL 296

  Fly   319 RSYEYYAESINSPKGFYGVPCSGLDELKGKNC 350
            |||:|||.||.:|.||.|.|||..::.:..:|
Mouse   297 RSYKYYASSILNPDGFLGYPCSSYEKFQHNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 95/273 (35%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 98/292 (34%)
Pancreat_lipase_like 65..363 CDD:238363 98/292 (34%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 4/27 (15%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 4/21 (19%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7466
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.