DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and LIPI

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001289927.1 Gene:LIPI / 149998 HGNCID:18821 Length:460 Species:Homo sapiens


Alignment Length:280 Identity:86/280 - (30%)
Similarity:131/280 - (46%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 WIDENN----FEFPQRHKRDTWQEM-------------------AE-----------KFNPELDT 141
            |:..:|    .||.|...:|:::::                   ||           .||.:..|
Human    12 WVRSDNKRPCLEFSQLSVKDSFRDLFIPRIETILMMYTRNNLNCAEPLFEQNNSLNVNFNTQKKT 76

  Fly   142 KILVHGWKS-STMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAVAKLID 205
            ..|:||::. .::...:|:.....:....:||..::|...|....|....:.|.:|..:::..|.
Human    77 VWLIHGYRPVGSIPLWLQNFVRILLNEEDMNVIVVDWSRGATTFIYNRAVKNTRKVAVSLSVHIK 141

  Fly   206 LLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIGPENHLDDTDAN 270
            .|::. .|..:..|.||.||||||.|:.|.....::.||||||||.|.|.. ..|.:.||.|||.
Human   142 NLLKH-GASLDNFHFIGVSLGAHISGFVGKIFHGQLGRITGLDPAGPRFSR-KPPYSRLDYTDAK 204

  Fly   271 FVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTG-----CSHGRSYEYYAESINS 330
            |||||||.:..||.::|:|.:|||||||. .||||.:  .||:|     |:|.|:...:..|:.:
Human   205 FVDVIHSDSNGLGIQEPLGHIDFYPNGGN-KQPGCPK--SIFSGIQFIKCNHQRAVHLFMASLET 266

  Fly   331 PKGFYGVPCSGLDELKGKNC 350
            ...|...||....:.|...|
Human   267 NCNFISFPCRSYKDYKTSLC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 85/276 (31%)
LIPINP_001289927.1 Pancreat_lipase_like 41..309 CDD:238363 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145233
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.