DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:268 Identity:94/268 - (35%)
Similarity:132/268 - (49%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 HKRDTWQEM---------AEKFNPELDTKILVHGWKSS-----TMSNSIQSIRGAYIERGQVNVF 173
            |..:.:||:         |..|..:..|:|.:.|||:.     .|.|.:       ::...:|..
Human    62 HNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKWQRDMCNVL-------LQLEDINCI 119

  Fly   174 AINW-KDQADNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYT 237
            .::| ....:.|:.:...|.   ||..||..||:|:::.:..|:::||||||||||:.|.|||  
Human   120 NLDWINGSREYIHAVNNLRV---VGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGS-- 179

  Fly   238 KYRV---NRITGLDPARPAFEDCIGPENHLDDTDANFVDVIHSCAGYLGFRKPIGMV------DF 293
              |:   .||||||||.|.|.: ...|..||.:|||||||||:.|..:.|...:|.:      ||
Human   180 --RIPGLGRITGLDPAGPFFHN-TPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDF 241

  Fly   294 YPNGGGPPQPGC----------------KELSQIFTGCSHGRSYEYYAESINSPKGFYGVPCSGL 342
            ||| ||...|||                ||::..| .|:|.|||::|||||.:|..|...||...
Human   242 YPN-GGKHMPGCEDLITPLLKFNFNAYKKEMASFF-DCNHARSYQFYAESILNPDAFIAYPCRSY 304

  Fly   343 DELKGKNC 350
            ...|..||
Human   305 TSFKAGNC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 94/268 (35%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 94/268 (35%)
Pancreat_lipase_like 52..348 CDD:238363 94/268 (35%)
PLAT_PL 355..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.