DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7367 and LOC100331214

DIOPT Version :9

Sequence 1:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:290 Identity:97/290 - (33%)
Similarity:132/290 - (45%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RHKRDTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQS-----IRGAYIERGQVNVFAINWKDQA 181
            |.|.:|....  .||....|.:::|||   |:|...:|     :...|......||..::|.|.|
Zfish    72 RGKAETLSSC--NFNHTSKTILVIHGW---TVSGLFESWVEKLVAALYNREKDANVIVVDWLDTA 131

  Fly   182 DNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITG 246
            .: :|:..|:.|..|||.:...||.:.|..:.....:||||:|||||:.|:|||:|..::.||||
Zfish   132 QD-HYVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSHTTNKIGRITG 195

  Fly   247 LDPARPAFEDCIGPENHLDDTDANFVDVIH-----SCAGYLGFRKPIGMVDFYPNGGGPPQPGC- 305
            ||||.|.||. :.....|...||:||||:|     |....:|..:|:|.||.|||||. .|||| 
Zfish   196 LDPAGPDFEG-VHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGS-FQPGCN 258

  Fly   306 ------KELSQ-IFT-----GCSHGRSYEYYAES-INSPKGFYGVPCSGLD----------ELKG 347
                  |..|. ||.     .|.|.||...:.:| :|.........|...|          ...|
Zfish   259 LRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAYSCGSNDMFDRGVCLQCRKNG 323

  Fly   348 KNCTG---GKILMGDPVPREARGI-FFVKT 373
            .|..|   .|:       |:||.: .|.||
Zfish   324 CNTVGYDISKV-------RKARSVKMFTKT 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 97/290 (33%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 97/290 (33%)
Pancreat_lipase_like 51..347 CDD:238363 97/290 (33%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.