DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tg and Tgm5

DIOPT Version :9

Sequence 1:NP_609174.1 Gene:Tg / 34093 FlyBaseID:FBgn0031975 Length:776 Species:Drosophila melanogaster
Sequence 2:XP_038962007.1 Gene:Tgm5 / 691932 RGDID:1593350 Length:431 Species:Rattus norvegicus


Alignment Length:436 Identity:138/436 - (31%)
Similarity:210/436 - (48%) Gaps:37/436 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 RSLGIPSRIITCYSSAHDTQASLTVDVFIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGVGEH 406
            |.||||:|:||.:.|.|||..:|.:|.:.|...:.|:....|::||:|||||.||.|.||..|  
  Rat     2 RCLGIPTRVITNFDSGHDTDGNLIIDEYYDNTGRILENMKKDTVWNFHVWNECWMARKDLPPG-- 64

  Fly   407 GTFDGWQVVDATPQEASDNMYRVGPASVAAVKNGDILRPFDGGFVFAEVNADKLYWR-YNGPSQP 470
              :.||||:||||||.|:.:|..|||||.|:|.|::...:|..|.|:.||||.:.|. |.|..|.
  Rat    65 --YGGWQVLDATPQETSNGLYCCGPASVKAIKEGEVDLNYDTRFAFSMVNADCMSWLVYGGKEQK 127

  Fly   471 LKLLRKDTLAIGHLISTKAVLKWEREDITDTYKHAERSEEERSTMLKALK--QSRHAFSRYYLND 533
               |.:||..:|:.||||::...||:|:|:.||:.|.|.:||...||||:  |:..:...:..|.
  Rat   128 ---LHQDTATVGNFISTKSIQSDERDDVTENYKYEEGSLQERQVFLKALQKLQAGRSQGPHQANS 189

  Fly   534 N-FN-----------------------DIEFDMELKDDIKIGQSFSVVLKVSNKSESRTHMATGQ 574
            | |:                       .:....||.|..|:||..:.||...|.|.....:.. .
  Rat   190 NPFSSMPPRQDSARSPTTPSLRPSDVLQVSLKFELLDSPKMGQDINFVLLAVNMSPQFKDLKL-N 253

  Fly   575 ISCDAVLYTGVGAVEVKTLGFELELEPKSSDYVRMEVIFEEYYDKLSSQAAFQISAAAKVKDTDY 639
            :|..::|:.|............:.|.||.......::::.:|...||:....:|||..:.|.:..
  Rat   254 LSAQSLLHDGSPLAPFWQDTAFITLFPKEEKTYPCKILYSQYSQYLSTDKLIRISALGEEKSSPE 318

  Fly   640 DYYAQDDFRVRKPDIKFQLGEAAIVAQKELDVILRLENPLPIPLHKGVFTVEGPGI-EQPLKFKI 703
            .........:..|.|...:..||.|.| .|.|.:...|||..|:...|.|:||.|: .:..:..|
  Rat   319 KILVNKIITLTFPGIMINVLGAAFVNQ-PLTVQVVFSNPLSEPVEDCVLTLEGSGLFRKQQRVLI 382

  Fly   704 AEIPVGGTAAATFKYTPPYAGRGTMLAKFTSKELDDVDGYRHYEIE 749
            ..:.....|:.|.|..|..:|:..:.|...|....|:.||::..::
  Rat   383 GVLKPHNKASITLKTVPFKSGQRQIQANLRSNRFKDIKGYKNVYVD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TgNP_609174.1 Transglut_N 56..179 CDD:279240
TGc 324..419 CDD:214673 36/76 (47%)
Transglut_C 538..644 CDD:279295 23/105 (22%)
Transglut_C 652..750 CDD:279295 28/99 (28%)
Tgm5XP_038962007.1 TGc <1..75 CDD:214673 36/76 (47%)
Transglut_C 218..317 CDD:395741 23/99 (23%)
Transglut_C 331..428 CDD:395741 28/97 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5648
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11590
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.