DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and si:ch73-106k19.2

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_009304583.2 Gene:si:ch73-106k19.2 / 799646 ZFINID:ZDB-GENE-131121-349 Length:284 Species:Danio rerio


Alignment Length:202 Identity:51/202 - (25%)
Similarity:85/202 - (42%) Gaps:29/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LKSIENEYDFFGFSTRLKPVVE-YIGNKYYANKKLHT----VDTVWYAASKELVD---------- 146
            :|:.|.:::.:...::.|..:: ::......||...|    ||.....|.:|..|          
Zfish    63 VKNREGDFNIYSIYSKSKDSLKSFLDTPGVINKDAFTLLAGVDIRHLGAVQEFADQHGIPSKVQG 127

  Fly   147 TFNIQV------------PPGLSLQHLTIEDAEIINENWPH-NKPGSIDFVRSLIKYNINLGAYD 198
            ..|:.|            ..|||...|:...|.::|..|.: ....|.:.|.:.|.:|.:|...:
Zfish   128 VMNVLVLQDQQQLQFKDRHAGLSFAPLSTAHAHLVNSTWKYGGDSSSYNSVLNYISHNPSLCVIE 192

  Fly   199 D-KGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSM 262
            : :.:.|:|.|..|..:||||..|..|:..|...|||..|:|.:...|..|...|..:|.||..:
Zfish   193 EGQTEPVSWLLVYPHAALGLLYTLPQHRCKGYARLLVSIMSKNLLEQGHPVYCFVEEENKPSYKL 257

  Fly   263 FEKLGFR 269
            |..|||:
Zfish   258 FTSLGFQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 27/78 (35%)
si:ch73-106k19.2XP_009304583.2 Gly_acyl_tr_N 9..187 CDD:310541 24/123 (20%)
NAT_SF 187..264 CDD:327402 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11093
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.