DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and Keg1

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_083826.1 Gene:Keg1 / 64697 MGIID:1928492 Length:295 Species:Mus musculus


Alignment Length:137 Identity:35/137 - (25%)
Similarity:55/137 - (40%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ENWPH-----NKPGSIDFVRSLIKYNINLGAY--DDK--------GKLVAWCLRLPIGS----LG 216
            :.||.     .:|...|....|..||.....|  |.|        .:::.|...|.|.|    ||
Mouse    47 DKWPDFNTVVIRPQEEDMTDDLDHYNNTYLVYSKDPKHCQEFLGSSEVINWKQHLQIQSSQSDLG 111

  Fly   217 LLQVLESHKRLGLGSL--------LVKSMAKKISAAGDQVLAPVVTKN--TP-SRSMFEKLGFRA 270
              :|:||.....||.:        :|...|||::.:.......||::|  || .:.:|:   |.:
Mouse   112 --KVIESLGATNLGKVKHKQCFLYMVCQTAKKLAPSLMDAKNLVVSRNKLTPLDQQLFK---FAS 171

  Fly   271 IDNTYWA 277
            :|.|:.|
Mouse   172 LDVTHAA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 27/108 (25%)
Keg1NP_083826.1 Gly_acyl_tr_N 10..205 CDD:283638 35/137 (26%)
Gly_acyl_tr_C 206..294 CDD:117021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.