DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and si:dkey-76k16.6

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001314704.1 Gene:si:dkey-76k16.6 / 566817 ZFINID:ZDB-GENE-090312-171 Length:295 Species:Danio rerio


Alignment Length:123 Identity:34/123 - (27%)
Similarity:56/123 - (45%) Gaps:6/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 DTFNIQVPPGLSLQHLTIEDAEIINENWPHNKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCLRL 210
            |:.:::: ..|:..||     |::|.||......|...::::|....:....|...:.|||.|..
Zfish   163 DSLSLKI-SSLNESHL-----ELVNSNWKFGCEDSKVMIKNMIANFPSCCVLDSDDQPVAWLLTY 221

  Fly   211 PIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGF 268
            ...:||:|..|..|:..|....||..|:||:.:.|..|......:|..|..:|..|||
Zfish   222 VSCALGILYTLPEHRGKGYAKALVTVMSKKLHSQGCPVYCFTEEENQLSYRLFTSLGF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 24/76 (32%)
si:dkey-76k16.6NP_001314704.1 Gly_acyl_tr_N 30..204 CDD:283638 10/46 (22%)
NAT_SF 205..283 CDD:302625 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11093
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.