DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and Glyatl3

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001138532.1 Gene:Glyatl3 / 435528 MGIID:3647683 Length:290 Species:Mus musculus


Alignment Length:263 Identity:55/263 - (20%)
Similarity:101/263 - (38%) Gaps:67/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NNFIKWVEID--PQLKVNFLSLNGDWQSDGTFVLTLRSDTHMNHIYFNTLSENLDRVTKA----- 93
            |.|.|.|.:|  |..||               ::|.|..        ...::|||..|.|     
Mouse    38 NPFQKEVVLDSWPNFKV---------------IITRRER--------EAETDNLDHYTNAYAVFY 79

  Fly    94 --LECLKSIENEYDFF---------GFSTRLKPVVEYIGNKYYANKKLHTVDTVWYAASKEL--- 144
              :...:.:..|:|..         |..:.|     |..:|..|..:|..:| :..|:.|.:   
Mouse    80 KDIRAYQQLLEEHDVINWDQVFQIQGLQSEL-----YAASKAVAKARLLDLD-INLASFKAVHFS 138

  Fly   145 ----VDTFNIQVPPGLSLQHLTIEDAEIINENWPHNKPGSIDFVRSLIKYNINLGA-------YD 198
                |...:....|...|.:|::.||:::|..|  ::.|:    :..::|..||.|       .|
Mouse   139 PVSSVPDHSFLTGPTPRLTYLSVSDADLLNRTW--SRGGN----QQCLRYLANLIACFPSVCVRD 197

  Fly   199 DKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMF 263
            :||..|:|.:.....::.....|..|:|.|...|:..::|:|:.:.|......|:..|..|.::.
Mouse   198 EKGNPVSWGITDQFATMCHGYTLPDHRRKGYSRLVALTLARKLQSRGFPSQGNVLDDNLASINLL 262

  Fly   264 EKL 266
            :.:
Mouse   263 KSV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 19/81 (23%)
Glyatl3NP_001138532.1 Gly_acyl_tr_N 10..192 CDD:368708 39/188 (21%)
NAT_SF 193..281 CDD:388411 16/73 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CTBC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.