DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and Glyat

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster


Alignment Length:274 Identity:89/274 - (32%)
Similarity:151/274 - (55%) Gaps:13/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IPRGEWTKLRDLYVARDTDPQGYPCINNFIKWVEIDPQLKVNFLSLNGDWQSDGTFVLTLRSDTH 74
            |.:.:|.:|||||....|:..|:..|..|:.::.:.....:...:.:.||::.|:::| :....:
  Fly     6 IEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTDTDWRTHGSYIL-IHYLEN 69

  Fly    75 MNHIYFNTLSENLDRVTKALECLKSIENEYDFFGFSTRLKPVVEYIGNKYYAN------KKLHTV 133
            ..:||.||:....:.:.|.|..|| ::..:...|:..|.||:||    .|:.|      ...|..
  Fly    70 KAYIYMNTIKGTPEDLGKLLNSLK-LKVFHLICGYEERFKPLVE----AYWLNLGQDLINLEHQG 129

  Fly   134 DTVWYAASKELVDTFNIQVPPGLSLQHLTIEDAEIINENWPHNKPGSIDFVRSLIKYNINLGAYD 198
            ..|::..|.| :.::...:.....:.::|...||:::::|.:....||..:|..::.|:.:|.:|
  Fly   130 AIVYHLPSTE-IPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSADSITMIRGFMENNLAVGVFD 193

  Fly   199 DKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMF 263
            ::|:.:|||||.|.|||..|.||.||:|:|||||.|:.||.:|...|.:|||.||.:|..|:.||
  Fly   194 NQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVVPENEGSQKMF 258

  Fly   264 EKLGFRAIDNTYWA 277
            |||||..|:..|||
  Fly   259 EKLGFNNINKLYWA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 44/83 (53%)
GlyatNP_001033883.2 RimI <155..264 CDD:223532 49/108 (45%)
NAT_SF 189..272 CDD:302625 44/82 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449947
Domainoid 1 1.000 55 1.000 Domainoid score I11093
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27163
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.