DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and CG15155

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster


Alignment Length:302 Identity:72/302 - (23%)
Similarity:108/302 - (35%) Gaps:114/302 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EWTKLRDLYVARDTDPQGYPCINNFIKWVEIDPQLK------------------------VNFLS 54
            ||.|    |.      :.|.|::.|::..:.|.|||                        |.||.
  Fly    22 EWPK----YC------KEYYCLDTFLELYKKDDQLKDVQVYALPNLELGIFVIVDHYQIFVGFLE 76

  Fly    55 LNGDWQSDGTFVLTL--------RSDTHMNHIYFNTLSE-------NLDRVTKALECLKSIENEY 104
            ..   ||:..|..:|        .....|...|||..::       .||     |:|:       
  Fly    77 AE---QSESLFKESLLKFKLYGGEQFASMPKRYFNVANDIIQAKNLKLD-----LDCV------- 126

  Fly   105 DFFGFSTRLKPVVEYIGNKYYANKKLHTVDTVWYAASKELVDTFNIQVPPGLSLQHLTIEDAEII 169
                                          |:....|||....|.::.|.|.||:.:.|:||::|
  Fly   127 ------------------------------TLSLVLSKEEALLFQVEPPAGFSLKPVDIDDAQVI 161

  Fly   170 NENWPHNKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLV 234
            |:.|..::|.|:..||..|                    ..|.|.|.:|||..::||.|.|.|:|
  Fly   162 NDQWEWSEPDSLSVVRRQI--------------------LAPDGLLAVLQVKTTYKRRGFGQLIV 206

  Fly   235 KSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYW 276
            |..|::.:..|...:..||.:|..|..:|.||||:..|..:|
  Fly   207 KEFARQEALLGRDTITEVVPENKASLGLFTKLGFKINDQCHW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 26/84 (31%)
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449952
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 1 0.900 - - E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.