DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and CG17681

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster


Alignment Length:296 Identity:96/296 - (32%)
Similarity:156/296 - (52%) Gaps:38/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTENSLVEIPRGEWTKLRDLYVARDTD-PQ---GYPCINNFIKWVEIDPQLK-VNFLSLNGDWQ 60
            |:|...|..|.  :...|:||.:....| |.   ||..::|:::|::.:|.|| :||.:|:.||:
  Fly     1 MATVGQLTRIT--DVANLKDLQILYLKDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTLDNDWR 63

  Fly    61 SDGTFVLTLRSDTHMNHIYFNTLSE---NLDRVTKALECLKSIENEYDFFGFSTRLKPVVEYIGN 122
            |||.|:|     .|...::|:.||:   :|:...|.|:..:         ||..   ..:..|.:
  Fly    64 SDGLFIL-----VHRYQLFFSNLSKQKTDLEVALKQLDWSR---------GFKV---SAIHEIHH 111

  Fly   123 KYYANKKL-------HTVDTVWYAASKELVDTFNIQVPPGLSLQHLTIEDAEIINENWPHNKPGS 180
            |.|....|       ..::|:.|..::|..:...||.|.|..|..:.:|.|::||:.|....|||
  Fly   112 KIYKQLALDLGLNMDREMNTIMYILNREEAERLQIQCPDGYFLDKVRLEHADLINDLWSARHPGS 176

  Fly   181 IDFVRSLIKYNINLGAYD-DKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAA 244
            :..::.||.||.|:|.|: :.|.|.||||||..|.||.|:||.:|:|.|||.::..:::|.|:..
  Fly   177 LKLIQMLITYNTNVGLYEKELGSLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATD 241

  Fly   245 GDQ-VLAPVVTKNTPSRSMFEKLGFRAI--DNTYWA 277
            ..| :.|.|...|:.:..:||||.||.|  ::.||:
  Fly   242 LQQDITALVNINNSAACRVFEKLNFRLIQDEHYYWS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 36/87 (41%)
CG17681NP_724098.2 FR47 189..277 CDD:117022 36/87 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449953
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 1 0.900 - - E1_2CTBC
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5352
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.