DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and CG15628

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster


Alignment Length:276 Identity:57/276 - (20%)
Similarity:104/276 - (37%) Gaps:67/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TKLRD------LYVARDTDPQGYPCINNFIKWVEIDPQLKVNFLSLNGDWQSDGTFVLTLRSDTH 74
            |.|.|      .|||:|...:  |.|.:| ....:.|.        |..:|:.|.|.    ...|
  Fly    41 TYLNDRIWDFKFYVAKDWPDK--PIILHF-PGCTLAPH--------NNIYQTLGIFC----PSAH 90

  Fly    75 MNHI----------------YFNTLSENLDRVTKALECLKSIENEYDFFGFSTRLKPVVEYIGNK 123
            :.|:                |.|...         :..:..:::.|..||...||...: |:.||
  Fly    91 IEHVDMLRTEDVLIDWQKPMYLNFTH---------IAIMNRLDDFYSKFGVMERLSGDI-YVCNK 145

  Fly   124 YYANKKLHTVDTVWYAASKELVDTFNIQVPPGLSLQHLTIEDAEIINENWPHNKPGSIDFVRSLI 188
            ..|:.:|.                   .:|....::.|.:::.:.|::.:|.|:...:.....|:
  Fly   146 LNADLELE-------------------PLPEDAEMRLLNLDNVQGIHDLYPANEIECVQLFDILV 191

  Fly   189 KYNINLGAY-DDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPV 252
            :....||.: .:.|:|.||.:....|::..:|.....:|:|.|..|.||:.:.:...|......:
  Fly   192 RKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLAKSLTQLVIERGYTPFVVI 256

  Fly   253 VTKNTPSRSMFEKLGF 268
            ...|..|||::.|||:
  Fly   257 RPGNDASRSLYTKLGY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 22/77 (29%)
CG15628NP_001260047.1 FR47 196..281 CDD:117022 22/77 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.