DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and Glyat

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001009648.1 Gene:Glyat / 293779 RGDID:1307163 Length:296 Species:Rattus norvegicus


Alignment Length:254 Identity:50/254 - (19%)
Similarity:93/254 - (36%) Gaps:69/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HMNH-------------IYFNT---------LSENLDRVTKALECL-KSIENEYDFFGFSTRL-- 113
            |:||             ..|||         :.::||..|...:.. |..||..:|.|.|..:  
  Rat    34 HVNHGNPFNLKALVDKWPDFNTVVVRPQEQEMKDDLDFYTNTYQIYSKDPENCQEFLGSSEVINW 98

  Fly   114 KPVVEYIGNKYYANK------KLHTV-----DTVWYAASK-------ELVDTFNIQVPPG----- 155
            |..::...::.:.||      .:|::     :.:.|..|:       .|:||.|:.  ||     
  Rat    99 KQHLQIQSSQSHLNKAIQNLASIHSLQVKHSENILYVVSETVRKLFPSLLDTKNLS--PGSGKPK 161

  Fly   156 ------LSLQHLTIEDAEIINENWPH-NKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCLRLPIG 213
                  ..|..|.:..|.::|:.|.. ....|..|:...||...:......:|...:|.|....|
  Rat   162 AINQEMFKLSSLDVTHAALVNKFWLFGGNERSQRFIERCIKNFPSSCVLGPEGTPASWTLMDQTG 226

  Fly   214 SLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLA----PVVTKNTPSRSMFEKLGF 268
            .:.:...:..::..||.|.::.|.        ||::.    ||.:....|.::.:|:.:
  Rat   227 EMRMGGTVPQYRAQGLVSFVIYSQ--------DQIMKKRGFPVYSHTDKSNTVMQKMSY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 14/80 (18%)
GlyatNP_001009648.1 Gly_acyl_tr_N 1..206 CDD:399190 36/173 (21%)
Gly_acyl_tr_C 207..295 CDD:117021 14/79 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.