DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and GLYATL2

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_659453.3 Gene:GLYATL2 / 219970 HGNCID:24178 Length:294 Species:Homo sapiens


Alignment Length:220 Identity:42/220 - (19%)
Similarity:75/220 - (34%) Gaps:62/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YFNTLS-----------ENLDRVTKALECLKSIENEYDFFGFSTRLKPVVEYI-----GNKYYAN 127
            |.|.:|           |.||...:.:...||::.:|        :|.:: :|     .:|..:|
Human    91 YSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDY--------MKTIL-FIPELPKKHKTSSN 146

  Fly   128 KKLHTVDTVWYAASKELVDTFNIQVPPGLSLQHLTIEDAEIINENWPHNK-PGSIDFVRSLIKYN 191
            .|:            ||.:..:.......|...|....|.::||:|...| ..|:.::...::..
Human   147 DKM------------ELFEVDDDNKEGNFSNMFLDASHAGLVNEHWAFGKNERSLKYIERCLQDF 199

  Fly   192 INLGAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVK------------SMAKKISAA 244
            :..|....:|:||:|.            |:|....|.:|..:.|            .:.|.:|..
Human   200 LGFGVLGPEGQLVSWI------------VMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQK 252

  Fly   245 GDQVLAPVVTKNTPSRSMFEKLGFR 269
            .......|...|..|......|||:
Human   253 EIPFYFHVADNNEKSLQALNNLGFK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 18/89 (20%)
GLYATL2NP_659453.3 Gly_acyl_tr_N 10..199 CDD:310541 24/128 (19%)
Gly_acyl_tr_C 202..290 CDD:117021 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.