DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and T10B10.4

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001024902.1 Gene:T10B10.4 / 181613 WormBaseID:WBGene00011681 Length:297 Species:Caenorhabditis elegans


Alignment Length:306 Identity:65/306 - (21%)
Similarity:105/306 - (34%) Gaps:90/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLVEIPRGEWTKLRDLYVARDTDPQGYPCI-----------NNFIKWVEIDPQLKVNFLSLNGDW 59
            |.:..|....|:|.|.:.........||.|           |.|||                   
 Worm    26 SAIYFPFSIHTQLEDSFPESPVRVFVYPNISHPKMFFMFKDNEFIK------------------- 71

  Fly    60 QSDGTFVLTLRSDTHMNHIYFNTLSENLDRVTKALECLKSIENEYDFFGFSTRLKP----VVEYI 120
               .|..|...|.|.||.:      |.:|.:           ||:....|..:.:|    ..|::
 Worm    72 ---PTLALAQVSGTSMNRL------ELIDLI-----------NEFRTRVFGAKRQPHLVIAEEHL 116

  Fly   121 GNKYYANKKLHTVD--------TVWY--AASKELVDTFNI-QVPPGLSLQHL-TIEDAEIINENW 173
            ...|....:|.:.|        :::|  .:.|:|..|..: .||.|.....: ..|:|||:|..|
 Worm   117 IKMYGVAMRLSSSDWTNNDLRLSLFYMTESQKKLAMTTPLPNVPHGYYYDEIEPTEEAEIVNNTW 181

  Fly   174 PHNKPGSID--------FVRSLIKYNINLGAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLG 230
            .|...|.::        ...|.:::|         ||.||:.:..|.|......|.|.|:|.|||
 Worm   182 KHAGAGDLEQTMAKLLRLPSSCVRFN---------GKPVAFEMIDPAGFFNNQYVFEDHRRKGLG 237

  Fly   231 SLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYW 276
            :.:...:..|..:.|   .:|..|....::.:.:    .:|.|..|
 Worm   238 NAVEMDLIHKTLSIG---FSPFKTVAKDNKIVLD----ASIANKLW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 20/84 (24%)
T10B10.4NP_001024902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.