DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and F43H9.4

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_505068.1 Gene:F43H9.4 / 179182 WormBaseID:WBGene00018400 Length:297 Species:Caenorhabditis elegans


Alignment Length:164 Identity:32/164 - (19%)
Similarity:59/164 - (35%) Gaps:27/164 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KPVVEYIGNKYYANKKLHTVDTVWYAASKE------------LVDTFNIQVPPGLSLQHLTIEDA 166
            |.:.:|: .|...|.::....|.::|.::.            |.|.::|.:|..      |.:..
 Worm   115 KAIEKYM-KKNNINAEVQNKSTHFFAMNESQIFKYRNYGDTTLPDGYSIDIPES------TNDVM 172

  Fly   167 EIINENWPHNKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGS 231
            :|:..:...|.....:.:|......:..|     .:||.:......|:|..|.|.:.|:...||.
 Worm   173 KIVGSSITPNAKLVEEKLRRFPSLCVRKG-----DELVGFISSETHGALAHLHVFDGHRGKNLGE 232

  Fly   232 LLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEK 265
            .|....||.....|   :.|....:|.:....||
 Worm   233 KLEIGAAKMAIENG---MRPCKFIDTTNSFFLEK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 18/73 (25%)
F43H9.4NP_505068.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.