DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and ZK185.3

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001370684.1 Gene:ZK185.3 / 177220 WormBaseID:WBGene00022683 Length:293 Species:Caenorhabditis elegans


Alignment Length:311 Identity:65/311 - (20%)
Similarity:106/311 - (34%) Gaps:96/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KLRDLYVARDTDPQGYPCINNFIKWVEID---PQLKVNFLSLNGDWQSDGTFVLTLRSDTHMNHI 78
            :||||.....:.|: :....|.:|: ||:   |....:|.|..             :|:.:..:.
 Worm     9 QLRDLLPFFTSHPK-FALFANAVKF-EIEKRLPNHPCDFYSYQ-------------KSEENAKYF 58

  Fly    79 Y---FNTLSE---------------NLDRVTKALECLKSIENEYD---FFGFSTRLKPVVEYIGN 122
            |   .|.|.:               |.|.|...||.:|:.|.|::   ....||.|..:      
 Worm    59 YCFRHNRLPDSCRPILMIGSVQTTVNGDDVICGLEQIKNSEPEFENIILLVASTELAKL------ 117

  Fly   123 KYYANKKLHTVDTV----------WY------AASKELVDTFNIQVPPGLSLQHLTIEDAEIINE 171
               |||.|.|...:          :|      ...:|.||  .|.:|...|:....:|||||:|.
 Worm   118 ---ANKYLTTCCNIRENYNVPCNNFYLPITVCPEIQEKVD--GITLPVSFSIGSTRLEDAEIVNS 177

  Fly   172 NWPHNKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCL---RLPI--------GSLGLLQVLESHK 225
            .|....|..|...:..|:            :|...|:   ..||        |.|.....:..::
 Worm   178 TWKFATPEDILQQKEKIQ------------RLPTACIFHEEKPIAFEMIGLHGQLSHQYTMPGYR 230

  Fly   226 RLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYW 276
            ..|.|:::..|:..|....|...:..|...|.|...       |::::..|
 Worm   231 NRGFGAIIENSIVSKCFREGITPVKSVELSNEPVLK-------RSLEHPLW 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 16/95 (17%)
ZK185.3NP_001370684.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20958
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.