DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and Glyatl2

DIOPT Version :10

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_599157.2 Gene:Glyatl2 / 171179 RGDID:621231 Length:295 Species:Rattus norvegicus


Alignment Length:140 Identity:30/140 - (21%)
Similarity:47/140 - (33%) Gaps:36/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ENWPH-----NKPGSIDFVRSLIKYNINLGAYDDKGK----------LVAWCLRLPIGS----LG 216
            :.||.     .:|...|....|..||.....|....|          ::.|...|.|.|    ||
  Rat    47 DKWPDFNTVVIRPQEQDMTDDLDHYNNTYLIYSKDPKHCQEFLGSSDVINWKQHLQIQSSQADLG 111

  Fly   217 LLQVLESHKRLGLGSL--------LVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAID- 272
              :|:|:.....||.:        :|...|||::.:.......||:...|:....:...|..:| 
  Rat   112 --KVIENLGATNLGKVKHKQCFLYMVSHTAKKLTPSLVDAKHLVVSSEKPTPFDHQLFKFARLDV 174

  Fly   273 ------NTYW 276
                  |:.|
  Rat   175 KHAALVNSIW 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 23/113 (20%)
Glyatl2NP_599157.2 Gly_acyl_tr_N 1..205 CDD:461802 30/140 (21%)
Gly_acyl_tr_C 206..294 CDD:117021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.