DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and GLYAT

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_964011.2 Gene:GLYAT / 10249 HGNCID:13734 Length:296 Species:Homo sapiens


Alignment Length:255 Identity:50/255 - (19%)
Similarity:82/255 - (32%) Gaps:79/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HMNH-------------IYFNT---------LSENLDRVTKALECLKSIENEYDFFGFSTRLKPV 116
            |:||             ..|||         ::::||..|          |.|..  :|...:..
Human    34 HINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYT----------NTYQI--YSKDPQNC 86

  Fly   117 VEYIGNKYYANKKLH---------------------------TVDTVWYAA--SKELVDTF---N 149
            .|::|:....|.|.|                           |...::.||  :|||....   .
Human    87 QEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSK 151

  Fly   150 IQVPPG----------LSLQHLTIEDAEIINENWPH--NKPGSIDFVRSLIKYNINLGAYDDKGK 202
            |..|.|          ..|..:.:..|.::|:.| |  ....|..|:...|:..........:|.
Human   152 ILSPNGGKPKAINQEMFKLSSMDVTHAHLVNKFW-HFGGNERSQRFIERCIQTFPTCCLLGPEGT 215

  Fly   203 LVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSM 262
            .|.|.|....|.:.:...|..::..||.:.::.|.|:|:...|..|.:.|...|...:.|
Human   216 PVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 16/70 (23%)
GLYATNP_964011.2 Gly_acyl_tr_N 11..206 CDD:310541 34/184 (18%)
Gly_acyl_tr_C 207..295 CDD:117021 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.