DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12560 and glyatl2

DIOPT Version :9

Sequence 1:NP_609173.2 Gene:CG12560 / 34092 FlyBaseID:FBgn0031974 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002941419.1 Gene:glyatl2 / 100490041 XenbaseID:XB-GENE-22068497 Length:282 Species:Xenopus tropicalis


Alignment Length:198 Identity:46/198 - (23%)
Similarity:85/198 - (42%) Gaps:29/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NEYDFF-GFSTRLKPVVEYIG----------NKYYANKKLH-----TVDT------VWYAASKEL 144
            |.|.|| ....|:..|:|:|.          ..|:.||..|     .|||      .:|..::: 
 Frog    71 NSYSFFIRDENRIHAVLEHINWNQAFEIQSMQNYFMNKIRHEAAQRNVDTEISLLRTYYQGTQK- 134

  Fly   145 VDTFNIQV---PPGLSLQHLTIEDAEIINENWPHNK-PGSIDFVRSLIKYNINLGAYDDKGKLVA 205
             :|...||   ...|....|:.....:::::|...: ..|.::|...||.:.:.... |.|..|:
 Frog   135 -ETGGEQVQRHQKNLEFCSLSPAYVSLVDDSWTFGRCSASQEYVSLCIKSHPSCCVL-DSGIPVS 197

  Fly   206 WCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRA 270
            |.|....|::.:|..:...:|.||||.:...:::.::.....:...|..:|.||:.||:.||.:.
 Frog   198 WVLCDHYGAMRMLYTVPQERRKGLGSKVCSVLSEIMTKQNRPIYCHVEEENIPSQLMFKDLGLQE 262

  Fly   271 IDN 273
            .::
 Frog   263 TES 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12560NP_609173.2 FR47 193..277 CDD:117022 20/81 (25%)
glyatl2XP_002941419.1 Gly_acyl_tr_N 10..186 CDD:368708 26/116 (22%)
NAT_SF 187..259 CDD:388411 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12326
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.