DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINB7

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:442 Identity:114/442 - (25%)
Similarity:187/442 - (42%) Gaps:88/442 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ANSVLNFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTS----RLHE 169
            |....|....:..:..||.. .:|.||:..:|||:.|||:..|..::..:..:...|    ..:.
Human     9 AEFCFNLFREMDDNQGNGNV-FFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNS 72

  Fly   170 QFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYR 234
            |.||..|           ..|..:|..||..           .:::.:.||||.:..|..:.||.
Human    73 QSGLQSQ-----------LKRVFSDINASHK-----------DYDLSIVNGLFAEKVYGFHKDYI 115

  Fly   235 RVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIA-SDIPQTTRMILANALYFKAF 298
            ....::|.:.::..||.......|.|||.:|...|...|:|:|. ..|..:..|:|.||:|||..
Human   116 ECAEKLYDAKVERVDFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGK 180

  Fly   299 WETDFIESATRPDNF-YPNGEGTEPVMRVQMMATGGAYPYHEDHEL--------GCKIIGLPYRG 354
            |::.|.:|.|...:| .|...|    ..|.||        |::.:.        ..||:.|.|.|
Human   181 WQSAFTKSETINCHFKSPKCSG----KAVAMM--------HQERKFNLSVIEDPSMKILELRYNG 233

  Fly   355 NLSTMYIIQPFKSSVRELMALQKRLTADKIESMIS--RMYRRAALVAFPKMHLTESVNLKTVMQR 417
            .:: ||::.|    ..:|..::.:||...:....:  ||..:...|.||:..:.::..:|..::.
Human   234 GIN-MYVLLP----ENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRA 293

  Fly   418 MGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVN 482
            :||..||...:.|||.||:         ||.                   |.:..::||....|.
Human   294 LGLKDIFDESKADLSGIAS---------GGR-------------------LYISRMMHKSYIEVT 330

  Fly   483 EQGTEA-AASSVTYLKKSGP-DVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |:|||| ||:....::|..| ..|||.|.||:.::|.|  .::||.|.::.|
Human   331 EEGTEATAATGSNIVEKQLPQSTLFRADHPFLFVIRKD--DIILFSGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 111/433 (26%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 113/440 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.