DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINH1

DIOPT Version :10

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001226.2 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:193 Identity:38/193 - (19%)
Similarity:60/193 - (31%) Gaps:82/193 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 HAITLLSVSHSQGARKMKNEREPLLGHAADGGSNGSGLDVAEHQRLLARPDLRSSPENMIVDPSN 65
            |:..|:.:..||....:..|.|              |.|::         .|.:|...:::||..
Human   298 HSAELVYILESQRLSVVLQEEE--------------GRDLS---------CLVASLVQVMMDPYF 339

  Fly    66 DT----DSLVSKEDPTYGSSSGEPYEPSMHRTLEHPTTNLDTMIHLLKGNIGTGILAM------- 119
            .|    .|||.||    ...:|.|:              ||...||.:....:.:..:       
Human   340 RTITGFQSLVQKE----WVMAGYPF--------------LDRCNHLKRSEKESPLFLLFLDTTWQ 386

  Fly   120 -----PDAFKHAGLY---------VGLFGTLFMGAVCTHCMHMLVNCSHELCRRLQVPSLSFA 168
                 |.||:.:..|         :.||||            .|.|..|:..::    |..||
Human   387 LLEQYPAAFEFSETYLAVLCDSTRISLFGT------------FLFNSPHQRVKQ----STEFA 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 serpin28D-like_insects 111..532 CDD:381061 14/79 (18%)
SERPINH1NP_001226.2 serpinH1_CBP1 36..417 CDD:381003 32/171 (19%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418 2/14 (14%)

Return to query results.
Submit another query.