DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINA6

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:451 Identity:111/451 - (24%)
Similarity:196/451 - (43%) Gaps:92/451 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 YVDLATSDR-IANSVLNFANILGQHLA--NGKTQIY-SPLSIVHSLALLLLGAKGRSYEEL--ST 157
            ||:::...| :|::.::||..|.:||.  :.|..|: ||:||..:||:|.||..|.:..:|  ..
Human    29 YVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGL 93

  Fly   158 VFDIPDTS--RLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANG 220
            .|::.:.|  .:|:.|    |.|.|                        ..|:...:.|:.:.|.
Human    94 GFNLTERSETEIHQGF----QHLHQ------------------------LFAKSDTSLEMTMGNA 130

  Fly   221 LFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTT 285
            ||......|...:...|...|.|::...:|: ..|||...||:||...|:..|.::. |.:....
Human   131 LFLDGSLELLESFSADIKHYYESEVLAMNFQ-DWATASRQINSYVKNKTQGKIVDLF-SGLDSPA 193

  Fly   286 RMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGL 350
            .::|.|.::||..|...|..::||.:|||.: |.|  |::|.||.......|..|.||.|:::.:
Human   194 ILVLVNYIFFKGTWTQPFDLASTREENFYVD-ETT--VVKVPMMLQSSTISYLHDSELPCQLVQM 255

  Fly   351 PYRGNLSTMYIIQPFKSSVRELMALQKR---------LTADKIESMISRMYRRAALVAFPKMHLT 406
            .|.|| .|::.|.|.|..:..::|...|         ||:.:::..|            ||:.::
Human   256 NYVGN-GTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYI------------PKVTIS 307

  Fly   407 ESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVD 471
            ...:|..|::.||:..:|           ||:|..:..       ..:||.::           .
Human   308 GVYDLGDVLEEMGIADLF-----------TNQANFSRI-------TQDAQLKS-----------S 343

  Fly   472 DIVHKVDFTVNEQGTEAAASSVTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            .:|||....:||:|.:.|.|:...|..:...::.|.:.||::::....|...||...:..|
Human   344 KVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 106/431 (25%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 106/433 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.