DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SRP3

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:460 Identity:101/460 - (21%)
Similarity:165/460 - (35%) Gaps:145/460 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ANILGQHLANGKTQ----IYSPLSIVHSLALLLLGAKG-------------RSYEELSTVFDIPD 163
            |.||..|:.:...:    |:||.||..::.:...|..|             .|.:||.|||    
plant    14 AMILSGHVLSSAPKDSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKTVF---- 74

  Fly   164 TSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYT 228
                               ||            .:|.:.::|.|  .|..::..||||:......
plant    75 -------------------RE------------LASVVYADRSA--TGGPKITAANGLWIDKSLP 106

  Fly   229 LNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIA-SDIPQTTRMILANA 292
            .:|.::.:....:.:.....||.......|..:|::|..||.|.|::::. ..:...|..|.|||
plant   107 TDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWVEHHTNNLIKDLLPDGSVTSLTNKIYANA 171

  Fly   293 LYFKAFWETDFIESATRPDNFY-PNGEGTEPVMRVQMMATGGAYPYHEDHEL-------GCKIIG 349
            |.||..|:..|.:..||.::|| .||             |..:.|:...:|.       |.|::.
plant   172 LSFKGAWKRPFEKYYTRDNDFYLVNG-------------TSVSVPFMSSYENQYVRAYDGFKVLR 223

  Fly   350 LPY-RGNLST-----MYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTES 408
            ||| ||:..|     ||...|.|....:.:..:...|...::|.|............||..:...
plant   224 LPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGFLDSHIPTYRDELEKFRIPKFKIEFG 288

  Fly   409 VNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDI 473
            .::.:|:.|:||..:                                                .:
plant   289 FSVTSVLDRLGLRSM------------------------------------------------SM 305

  Fly   474 VHKVDFTVNEQGTEAAAS--------SVTYL---KKSGPDVLFRGDTPFMVLVRHDPTKLVLFYG 527
            .||....::|:|.||||:        |:.::   ||    :.|..|.||:.|:|.:.|..|||.|
plant   306 YHKACVEIDEEGAEAAAATADGDCGCSLDFVEPPKK----IDFVADHPFLFLIREEKTGTVLFVG 366

  Fly   528 LINEP 532
            .|.:|
plant   367 QIFDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 98/453 (22%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 100/458 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.