DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and AT3G45220

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:434 Identity:110/434 - (25%)
Similarity:190/434 - (43%) Gaps:78/434 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILGQH----LANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDL 178
            :|.:|    :|||...::||:||...|.|:..|:...:.|::.:...:|.:..|:..       |
plant    16 LLAKHVIPTVANGSNLVFSPMSINVLLCLIAAGSNCVTKEQILSFIMLPSSDYLNAV-------L 73

  Fly   179 QQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYAS 243
            .:....|::.|...:|...|:|.                  |::.....:..|.::.::...|.:
plant    74 AKTVSVALNDGMERSDLHLSTAY------------------GVWIDKSLSFKPSFKDLLENSYNA 120

  Fly   244 DLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTTR---MILANALYFKAFWETDFIE 305
            .....||...||.....:||:...||...|:.|::.|..:|.|   :|||||:|||..|...|..
plant   121 TCNQVDFATKPAEVINEVNAWAEVHTNGLIKEILSDDSIKTIRESMLILANAVYFKGAWSKKFDA 185

  Fly   306 SATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLS--TMYIIQPFKSS 368
            ..|:..:|:.. :||  :::|..| |.....|.|.:: |.|::.|||..:..  .|||..|   :
plant   186 KLTKSYDFHLL-DGT--MVKVPFM-TNYKKQYLEYYD-GFKVLRLPYVEDQRQFAMYIYLP---N 242

  Fly   369 VRE-LMALQKRLTADK--IESMISRMYRRAALVAF--PKMHLTESVNLKTVMQRMGLGGIFSAVQ 428
            .|: |..|.:.:::..  :::.|.|  :|....||  ||...:.......|::.|||        
plant   243 DRDGLPTLLEEISSKPRFLDNHIPR--QRILTEAFKIPKFKFSFEFKASDVLKEMGL-------- 297

  Fly   429 NDLSLIATNEATRTNALGGNSL-QNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASS 492
                .:.....:.|..:...|: :||         ....:|.|.::.||....|:|:||||||.|
plant   298 ----TLPFTHGSLTEMVESPSIPENL---------CVAENLFVSNVFHKACIEVDEEGTEAAAVS 349

  Fly   493 VTYLKKSGPDVLFRG----DTPFMVLVRHDPTKLVLFYGLINEP 532
            |..:.|   |:|..|    |.||:..||.:.:.::||.|.:.:|
plant   350 VASMTK---DMLLMGDFVADHPFLFTVREEKSGVILFMGQVLDP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 108/427 (25%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 109/432 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.