DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina7

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:417 Identity:95/417 - (22%)
Similarity:171/417 - (41%) Gaps:87/417 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 YSPLSIVHSLALLLLGAKGRSYEELSTV--FDIPDT--SRLHEQFGLMLQDLQQPTREAISAGRP 191
            :||:||..:||:|..|:...:..::..|  |::.||  ..|.:.|..::..|..|..|.      
  Rat    79 FSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKELQQGFQHLICSLNFPNNEL------ 137

  Fly   192 LTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNP--DYRRVIVEVYASDLQIQDFEGSP 254
                                  |:.:.|.:|  .|..|.|  .:...:..:|.:::...||....
  Rat   138 ----------------------ELQMGNAVF--IGQQLKPLAKFLDDVKTLYETEVFSTDFSNVS 178

  Fly   255 ATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEG 319
            | |::.||:||.:.||..|..:| .|:.....|||.|.::|||.|...|..|.|...:.:...:.
  Rat   179 A-AQHEINSYVEKQTKGKIVGLI-QDLKLNIIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKS 241

  Fly   320 TEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKI 384
            |  .::|.||.....|.::.|.||.|.::.:.|..|...:::: |.:..:..:.|.....|..|.
  Rat   242 T--TVQVPMMHQLEQYYHYVDVELNCTVLQMDYSANALALFVL-PKEGHMEWVEAAMSSKTLKKW 303

  Fly   385 ESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNS 449
            ..::.:.:   ..:..||..::.:.:|.:.:|:||:...| |...|...|     |:.|.     
  Rat   304 NHLLQKGW---VELFVPKFSISATYDLGSTLQKMGMRDAF-AESADFPGI-----TKDNG----- 354

  Fly   450 LQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSG----PDV-----LF 505
                              |.:....||....:.|:||:..||     .::|    |:|     :.
  Rat   355 ------------------LKLSYAFHKAVLHIGEEGTKEGAS-----PEAGSLDQPEVAPLHAVI 396

  Fly   506 RGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |.|..|::::....|:.|||.|.:.:|
  Rat   397 RLDRTFLLMILEKRTRSVLFLGKVVDP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 93/410 (23%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 95/417 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.