DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb12

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001186142.1 Gene:Serpinb12 / 71869 MGIID:1919119 Length:423 Species:Mus musculus


Alignment Length:429 Identity:105/429 - (24%)
Similarity:196/429 - (45%) Gaps:66/429 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSR-LHEQFGLMLQDLQQPTREAISAGRPLTDWR 196
            |||:..:..::.|||:|.|..::.......:.|: .|::     .:...|..|:.::...|...:
Mouse    32 PLSLSAAFGMVRLGARGDSAHQIDEALHFNELSKDEHKE-----PNDPSPQSESKASDSSLEGQK 91

  Fly   197 ASSAMR-----SNRRAQRPGAH---------------EVHLANGLFTQTGYTLNPDYRRVIVEVY 241
            .:||.:     |....|..|.|               .:.:||.|:.:..:.:..:|...:.|.:
Mouse    92 QTSASQDQQGESTNDHQLLGCHFGKLLSRIDRDKSYYTLSMANRLYGEQEFPICSEYSDDVTEFF 156

  Fly   242 ASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRMILANALYFKAFWETDFIE 305
            .:.::..||:.....:|..||.:|...::..|:.:...: |..:|.::|.||:||||.||.:|..
Mouse   157 HTTVESVDFQKDSEKSRQEINFWVESQSQGKIKELFGKEAIDNSTVLVLVNAVYFKAKWEREFNS 221

  Fly   306 SATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQP--FKSS 368
            ..|...:|..|....:   .|:||...|.:......||..:|:.:.|.....:|.::.|  .:.:
Mouse   222 ENTVDASFCLNENEKK---TVKMMNQKGKFRIGFIDELQAQILEMKYAMGKLSMLVLLPSCSEDN 283

  Fly   369 VRELMALQKRLTADKIESMIS--RMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDL 431
            |..|..|:|::..:|:.:..|  .:..:...::||:.:|.:|.:||:::|.||:..:|...:.||
Mouse   284 VNSLQELEKKINHEKLLAWSSSENLSEKPVAISFPQFNLEDSYDLKSILQDMGIKDVFDETKADL 348

  Fly   432 SLIATNEATRTNALGGNSLQNLEAQRRAGTGGARS-DLVVDDIVHKVDFTVNEQGTEAAASS-VT 494
                                         ||.::| :|.:..||||....|:|.||:|||:| |.
Mouse   349 -----------------------------TGISKSPNLYLSKIVHKTFVEVDEMGTQAAAASGVV 384

  Fly   495 YLKKSGPD-VLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            ..:|:.|. |.|..:.||:..:||:||:.:||.|.:..|
Mouse   385 AAEKALPSWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 103/422 (24%)
Serpinb12NP_001186142.1 SERPIN 4..423 CDD:294093 104/427 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..106 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.