DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpine3

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:445 Identity:92/445 - (20%)
Similarity:171/445 - (38%) Gaps:111/445 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FANILGQHLA---NGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQ 176
            ||..|.|..|   ||...:.||.|:..||.:|...|:|.:..:|:            |..|..:|
  Rat    35 FALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLA------------EALGYTVQ 87

  Fly   177 DLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVY 241
            |.:  .||.:.          :..:..:..:|..|   :.||..||.|||.:|:|.:...:....
  Rat    88 DPR--VREFLH----------TVYITLHNSSQGIG---MELACTLFMQTGTSLSPCFVEQVSRWA 137

  Fly   242 ASDLQIQDF--------EGSPATARYNINAYVAQHTKNHIENIIASDIPQT-------------- 284
            .|.|::.||        |.|..|.|                       |.|              
  Rat   138 NSSLELADFSEPNTTTMEASKGTTR-----------------------PSTGEGPGSPLWGRAGA 179

  Fly   285 --TRMILANALYFKAFWETDFIESATRPDNF-YPNGEGTE-PVMRVQMMATGGAYPYHEDHELGC 345
              |::.:.:.:.|::.|:..|...|.:|..| ..:|...: |.|......:.|.:.....|::  
  Rat   180 LSTQLSIVSTMTFQSSWQQRFSSVALQPLPFTCAHGLVLQVPAMHQVAEVSYGQFQDAAGHKV-- 242

  Fly   346 KIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVN 410
            .::.|.|.|.::::.::.| :.....|..::..|||..|....:|:.|....|..|:..:....:
  Rat   243 DVLELLYLGRVASLLLVLP-QDKGTPLDHIEPHLTARVIHLWTTRLKRARMDVFLPRFRIQNQFD 306

  Fly   411 LKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVH 475
            ||::::..|:..:|..::.:|.                           |..| |....|.::.|
  Rat   307 LKSILRSWGITDLFDPLKANLK---------------------------GISG-RDGFYVSEVTH 343

  Fly   476 KVDFTVNEQGTEAAASSVTYLKKSGPDVLFRGDTPFMVLVR-HDPTKLVLFYGLI 529
            |....::|:||::.|::...|.:......|:.|.||:.|:| |:...:.:.:|.:
  Rat   344 KAKMELSEEGTKSCAATAVLLLRRSRTPAFKADRPFIFLLREHNTVAVRITHGKV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 91/441 (21%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 92/445 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.