DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina1f

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:463 Identity:94/463 - (20%)
Similarity:195/463 - (42%) Gaps:90/463 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TSVKPSNLPAAYSNGYVDLATSDRIANSVLNFANILGQHLA----NGKTQIYSPLSIVHSLALLL 144
            |..|...|   |.:..:|.....::|.::.|.:..|.:.:|    ||.. ::||:.::.::::|.
Mouse    23 TKTKHEKL---YEDPSIDPFQCRKVALTICNVSITLFKKMAQLSGNGNI-LFSPIRVIAAISMLS 83

  Fly   145 LGAKGR-SYEELSTV-FD---IPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSN 204
            ||:.|. |...|.|: |:   :|: :.:|:.|..:|..:.| |.|..|                 
Mouse    84 LGSNGNLSKHILETLRFNKTGLPE-AEIHKCFWYLLHSIHQ-TEEPSS----------------- 129

  Fly   205 RRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHT 269
                      :...:.:|.....|....:.:.:.::|.||:...:|..| :.|:..||.||.:.:
Mouse   130 ----------LQTGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINFTDS-SQAKTQINNYVMEKS 183

  Fly   270 KNHIENIIASDIPQTTRMILANALYFKAFWETDF-IESATRPDNFYPNGEGTEPVMRVQMMATGG 333
            :..|.||: .::...|.:.:.|.:.:.|..:::| ..|....|  |..|.|.  .::|.|:....
Mouse   184 QKEIVNIV-KNLESDTFLAVVNYIIWNAKLDSNFGCRSVKVKD--YHLGYGM--TIKVPMIHNMA 243

  Fly   334 AYPYHEDHELGCKIIGLP-YRGNLSTMYII-QPFKSSVRELMALQKRLTADKIESMISRMYRRAA 396
            .:......:|...::.|. ..||.:|.:|| .|.|     :..:::.||......|..::..|..
Mouse   244 MHYLFRVEDLSSTVLMLTLLTGNFATYFIIPDPGK-----MQKVEQSLTYPHFRRMRRQLLTRLV 303

  Fly   397 LVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGT 461
            .:..|::.|:|:.:|:::|..:|:..:|::        .||.:...:.|..:.            
Mouse   304 DLEIPELSLSETHDLESMMSLLGITYVFNS--------GTNSSDMNDTLQKSF------------ 348

  Fly   462 GGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSGPDVLFRG--DTPFMVLVRHDPTKLVL 524
                      .:|.|...|::|:|::.:.:|.  .||.|...:.|.  :.||::.::.....:.|
Mouse   349 ----------KVVSKAVLTIDEKGSKPSTNSC--FKKLGSTDMGRMQLNRPFLIFIQDHTNDVPL 401

  Fly   525 FYGLINEP 532
            |.|.:..|
Mouse   402 FLGRVVNP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 86/429 (20%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 87/433 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.