DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina12

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:440 Identity:113/440 - (25%)
Similarity:194/440 - (44%) Gaps:89/440 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RIANSVLNFANILGQHLANGKTQ---IYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSR-- 166
            ::|...:.|...|.|.||:...|   ..|||||..:.::|.|||:..:.||:...|:..:.|.  
Mouse    47 QLARHNMEFGFKLLQRLASNSPQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSNWD 111

  Fly   167 LHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNP 231
            :|..|..:|..|.|.|.:.                            :::|.|.||..  ..|.|
Mouse   112 VHAAFHYLLHKLNQETEDT----------------------------KMNLGNALFMD--QKLRP 146

  Fly   232 DYR--RVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALY 294
            ..|  .:...||.:|:.:.:|:....|.: :||.|::|.|.:.|:|::.|..|.|. |||.|.:|
Mouse   147 QQRFLNLAKNVYDADMVLTNFQDLENTQK-DINRYISQKTHSRIKNMVKSIDPGTV-MILTNYIY 209

  Fly   295 FKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTM 359
            |:..|:.:|....|:.:.|:.....|   ::|.||...|.|....|.:|.|.|:.:|||||::..
Mouse   210 FRGRWQYEFDPKQTKEEEFFIEKGKT---VKVPMMFQRGLYDMAYDSQLSCTILEIPYRGNITAT 271

  Fly   360 YIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIF 424
            ::: |...   :|..|::.|.||......|.:.:|...|..||:.::.:.|:|.|:.|:|:..||
Mouse   272 FVL-PDNG---KLKLLEQGLQADIFAKWKSLLSKRVVDVWVPKLRISSTYNMKKVLSRLGISKIF 332

  Fly   425 SAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAA 489
            .. ..||:.|:::.:                            |.|.:.|||.:..::|:|.|.|
Mouse   333 EE-NGDLTRISSHRS----------------------------LKVGEAVHKAELKMDEKGMEGA 368

  Fly   490 ASSVTYLKKSGPDVL-------FRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |.       ||...|       .:.|.||::::..:....::|...|.:|
Mouse   369 AG-------SGAQTLPMETPRHMKLDRPFLMMIYENFMPSMVFLARIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 110/429 (26%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 110/431 (26%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.