DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb1a

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_079705.2 Gene:Serpinb1a / 66222 MGIID:1913472 Length:379 Species:Mus musculus


Alignment Length:415 Identity:118/415 - (28%)
Similarity:189/415 - (45%) Gaps:78/415 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 YSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDW 195
            :||.||..:||:::|||||.:..:||..|.......:|.:|    |.|                 
Mouse    30 FSPFSISSALAMVILGAKGSTAAQLSKTFHFDSVEDIHSRF----QSL----------------- 73

  Fly   196 RASSAMRSNRRAQRPGA-HEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARY 259
                    |....:.|| |.:.|||.|:.:..|...|:|.....::|.:||...||..:...||.
Mouse    74 --------NAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASTQKMYGADLAPVDFLHASEDARK 130

  Fly   260 NINAYVAQHTKNHIENIIASDIPQT-TRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPV 323
            .||.:|...|:..|..:::..:..: |:::|.||:|||..||..|:...|....|..:.:.|:  
Mouse   131 EINQWVKGQTEGKIPELLSVGVVDSMTKLVLVNAIYFKGMWEEKFMTEDTTDAPFRLSKKDTK-- 193

  Fly   324 MRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQP--FKSSVRELMALQKRLTADKIES 386
             .|:||.....:|:....:|.||::.:||:|...:|.|:.|  .:.....|..::|::|.:|   
Mouse   194 -TVKMMYQKKKFPFGYISDLKCKVLEMPYQGGELSMVILLPKDIEDESTGLKKIEKQITLEK--- 254

  Fly   387 MISRMYRRAAL------VAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNAL 445
             :....:|..|      |..|:..:.||..|.:.:.|:|:..:||:.:.|||             
Mouse   255 -LLEWTKRENLEFIDVHVKLPRFKIEESYTLNSNLGRLGVQDLFSSSKADLS------------- 305

  Fly   446 GGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASS---VTYLKKSGPDVLFRG 507
                          |..|:| ||.:..||||....|||:||||||::   .|:.... |:..|..
Mouse   306 --------------GMSGSR-DLFISKIVHKSFVEVNEEGTEAAAATGGIATFCMLL-PEEEFTV 354

  Fly   508 DTPFMVLVRHDPTKLVLFYGLINEP 532
            |.||:..:||:||..|||.|.:..|
Mouse   355 DHPFIFFIRHNPTSNVLFLGRVCSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 116/408 (28%)
Serpinb1aNP_079705.2 serpinB1_LEI 1..379 CDD:381028 117/413 (28%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 351..379 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.