DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINE3

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:442 Identity:94/442 - (21%)
Similarity:162/442 - (36%) Gaps:102/442 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FANILGQHLA---NGKTQIYSPLSIVHSLALLLLGAKGRSYEELS-----TVFDIPDTSRLHEQF 171
            ||..|.|.:|   |....:.||..:...|.:|..||:|.:.::|:     ||.|......||..:
Human    33 FALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKDFLHAVY 97

  Fly   172 GLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRV 236
            ..:      ||.   |.|.                       |:.||..||.|.|..|:|.:...
Human    98 ATL------PTS---SQGT-----------------------EMELACSLFVQVGTPLSPCFVEH 130

  Fly   237 IVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQT--------------TRM 287
            :.....|.|:..|.....:|         |..|........|...|..              .::
Human   131 VSWWANSSLEPADLSEPNST---------AIQTSEGASRETAGGGPSEGPGGWPWEQVSAAFAQL 186

  Fly   288 ILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMM--ATGGAYPYHED---HELGCKI 347
            :|.:.:.|:..|...|..:.|:   ..|.......|::|.||  .|...|...:|   |::|  :
Human   187 VLVSTMSFQGTWRKRFSSTDTQ---ILPFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVG--V 246

  Fly   348 IGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLK 412
            :.|||.|:..:::::.| :.....|..::..|||..|....:.:.|....|..|:..:....|||
Human   247 LELPYLGSAVSLFLVLP-RDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLK 310

  Fly   413 TVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKV 477
            :::...|:..:|..::.:|.                           |..| :....|.:.:||.
Human   311 SILNSWGVTDLFDPLKANLK---------------------------GISG-QDGFYVSEAIHKA 347

  Fly   478 DFTVNEQGTEAAASSVTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLI 529
            ...|.|:||:|:.::...|.|.....:|:.|.||:..:|...|.:.:|:..|
Human   348 KIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 93/438 (21%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 93/440 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.