DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb2

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_067728.1 Gene:Serpinb2 / 60325 RGDID:621823 Length:416 Species:Rattus norvegicus


Alignment Length:458 Identity:121/458 - (26%)
Similarity:202/458 - (44%) Gaps:80/458 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IANSVLNFA-NILGQHLANGKTQ--IYSPLSIVHSLALLLLGAKGRSYEELSTV--------FDI 161
            :||::  || |:|.|...:..||  ..||.||..:||::.|||:..:.|:::.|        :|:
  Rat     6 MANTM--FALNLLKQIEQSNSTQNIFISPWSISSTLAIVFLGAQANTEEQMAKVLNFDKIGSYDL 68

  Fly   162 P----------DTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVH 216
            .          |.::..::....:..||...|:.|.:        |.|::.|.....|.|.:.:.
  Rat    69 TPGNPENFHGCDFAQHIQRDNYPVAILQAQARDKIHS--------AFSSLSSTINTPRLGDYLLE 125

  Fly   217 LANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENII-ASD 280
            .||.||.:.......:|.:...:.|:::.:..||......||..||::|...||..|.|:: ...
  Rat   126 SANKLFGEKSARFKEEYIQRCKKYYSTEPEAVDFLECANEARKKINSWVKTQTKGEIPNLLPEGS 190

  Fly   281 IPQTTRMILANALYFKAFWETDFIESATRPDNFYP---NGEGTEPVMRVQMMATGGAYPYHEDHE 342
            :.:.|:|:|.|.:|||..|:|.|   ..|.:..||   |...::|   ||||............:
  Rat   191 VDEDTKMVLVNTIYFKGRWKTPF---QKRLNGLYPFRVNLNESKP---VQMMYLREKLNIGYIKD 249

  Fly   343 LGCKIIGLPYRGNLSTMYIIQP--FKSSVRELMALQKRLTADKIESMISR--MYRRAALVAFPKM 403
            |..:|:.|||.||:| |:::.|  .:.|...|..|::.:..|.....||:  :.....||..||.
  Rat   250 LKTQILELPYIGNIS-MFLLLPDEIEDSSTGLEMLEREINFDNFNKWISKETLDEDDVLVYIPKF 313

  Fly   404 HLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDL 468
            .|.::..||.::||||:...|:..:.|.|              |.|..|              ||
  Rat   314 KLAQNYELKPILQRMGMEDAFNKGKADFS--------------GMSESN--------------DL 350

  Fly   469 VVDDIVHKVDFTVNEQGTEAAASSVTYLK----KSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLI 529
            .:.::.|:....|||:||.||..:...:.    ..||.  |..|.||:..:.::.|:.:||.|..
  Rat   351 FLSEVFHQATVDVNEEGTVAAGGTGAVMTGRTGHGGPQ--FVADHPFLFFIMNNITRTILFVGRF 413

  Fly   530 NEP 532
            :.|
  Rat   414 SSP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 117/448 (26%)
Serpinb2NP_067728.1 serpinB2_PAI-2 2..416 CDD:381029 120/456 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.