DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and serpinb14

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_002665111.3 Gene:serpinb14 / 569051 ZFINID:ZDB-GENE-050506-148 Length:437 Species:Danio rerio


Alignment Length:458 Identity:128/458 - (27%)
Similarity:212/458 - (46%) Gaps:76/458 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVF---DIPD----TSRLHEQFG 172
            |..|.|.: |:|.. .|||:||..:||::.|||||.:.:::..|.   ::|.    |...|:.  
Zfish    16 FKKISGGN-ASGNV-FYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNLPKSAGATPEAHQS-- 76

  Fly   173 LMLQDLQQP---------------TRE-----AISAGRPLTDWRASSAMRSN-----RRAQRPGA 212
             |:|..|:|               |::     .:..|..:...:|...:.||     ....:|||
Zfish    77 -MMQQAQKPKSGVKDQHGQAMMQQTQKIDIPAELKKGSAVPGQKAEEQIHSNFNKFMSELNKPGA 140

  Fly   213 -HEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENI 276
             :.:.|||.|:.:..|.....:.......|.:.|:..||:.....||.|||.:|.::|:..|:::
Zfish   141 PYVLSLANRLYGEQTYQFVEKFLSDAKRYYEAGLEKVDFKNKSEAARVNINTWVEKNTQEKIKDL 205

  Fly   277 IASD-IPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHED 340
            :.|. |...||::|.||:|||..||..|.:.||....|..|...|:|   |:||.....:|....
Zfish   206 LPSGAIDAMTRLVLVNAIYFKGNWERKFPKEATNDGQFKLNKNQTKP---VKMMYQKAHFPLASI 267

  Fly   341 HELGCKIIGLPYRGNLSTMYIIQP--FKSSVRELMALQKRLTADKIESMISR--MYRRAALVAFP 401
            .|:..:::.|||.|...:|.||.|  .:.:...|..|:|.||.:|:......  |.::...|:.|
Zfish   268 PEMNSQVLELPYVGKNLSMLIILPDQIEDATTGLEKLEKALTYEKLMEWTKPEVMRQQEVQVSLP 332

  Fly   402 KMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARS 466
            |..:.::.::|:::..||:..:|             :..:.|..|.:|               .:
Zfish   333 KFKMEQTYDMKSLLVSMGMEDVF-------------DPQKVNLTGMSS---------------SN 369

  Fly   467 DLVVDDIVHKVDFTVNEQGTEAAAS--SVTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLI 529
            |||:..::||....|||:||||||:  ::..|:.......|..|.||:..:||:|||.:||||..
Zfish   370 DLVLSKVIHKAFVEVNEEGTEAAAATGAIMMLRCIRLPQSFNADHPFLFFIRHNPTKSILFYGRF 434

  Fly   530 NEP 532
            ..|
Zfish   435 CSP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 125/451 (28%)
serpinb14XP_002665111.3 SERPIN 4..437 CDD:294093 127/456 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.